Mello (or, his real name, Mihael Keehl [awesome right]) is a Death Note character appearing in the second half of the anime (episodes 25 to 37) first appearing in Episode 26: Renewal, and in the second half of the manga (appearing first in Chapter 59: Zero). He is a part of the 4th generation of Wammy's House successors, 2nd place to Near. Wammy's House is an institution/organization run by Quillish Wammy & Roger, an orphanage for gifted children (and out of all of them, only a few are selected to be L, the greatest detective in the world's possible successors/heirs). (Wammy's House is very fun as you can see!! :3 XD >_< /sarcasm)

Mello is a very wholesome, fun guy, y'know? He exploded, TWICE, canonically almost started World War 3, is the best dresser that died like a dog, shot a rival gang member even Kira couldn't catch (oh yeah he was in the mafia for a while after running away from Wammy's House, which I can yap about more in a bit), blackmailed the president of the US (to get funds and aid for pursuing Kira or he would go ahead and use the Death Note to drop a bunch of nuclear missiles into the USA. Thus almost starting WWIII. As I said), and has an inferiority complex to his rival Near. All while in his kickass boots and black lip gloss and nail polish, oh yes, and being doomed by the narrative while serving ykwhat.

And he's probably gay. (my headcanons btw cause. no wait this is One Hundred Percent Canon Fact No Fallacy) (gay for Matt ifykwimmememeememmeemmemeankssskj :3)

Don't worry, though. Mello has a good heart inside, just. Loves Doing Bad Things to get what he wants causeeeee he never catches a break trying to prove the world he is the worthy successor to L, and not Near. He and Near were offered to work together, but Mello doesn't play those games unfortunately. He also has a lust/yearning for victory to fulfill his ego (he's L's other half, what did you expect??) Mello is also extremely smart, but does tend to let his emotions interfere with his plans or trains of thought.

Alot like how L has his sweet tooth, this firecracker loves chocolate. I mean, if you remembered him from the series, you most likely remember him as "that one guy after L went to get the milk that ate chocolate a bunch". (unless you are Extremely Not Normal about death note like i am ykykyk). (kind of strange how he doesn't even tremble from the amount of stimulants in those things. anywhoozles) I headcanon he eats a lot of chocolate though due to him having OCD, and eats it as a compulsory thing to distract himself from threatening intrusive thoughts, and also as a way to focus or gather himself together. He eats chocolate differently in the anime and manga, where in the anime he takes loud, crisp bites straight off of the chocolate bar, and in the manga, he licks it until it's all melty and then puts the residue on his gloved fingers to lick it off (cause he's a fREEEAAKkkK..) But yeah! It is definitely one of the most notable things about his character.


Also, you know how I said he got into the mafia earlier? So how THAT happened was, L poofed right?? (how many more euphemisms will I use my lawd my gosh...) so yeah L episode25'd and so, segue to Near and Mello in Roger's office in the Wammy's circa 2004, Roger is like, "Okay so yall L did NOT choose one of you, so I suggest you work together" and Mello is like "HELL NOOOO I'mma do my own thing!!!!" and Near is like *does a puzzle that is completely blank except for L's insignia or whatever its called in the corner of it* *nonchalantly says* "If you don't solve the puzzle... if you don't win the game... then you're just a loser." Mello's live reaction: >:((((!!! (Mello was also very shocked and sad that L died, while Near didn't show much emotion. Not necessarily because he didn't care, but because Near struggles to show emotions. On the inside, he was furious of Kira, and that's how the SPK, Special Provision for Kira happened. This page is about Mello though, so back to him) (but yes Mello was also promised L would catch Kira, but ofc L just HAD to. episode25'ded) This prompts Mello to pack his things and flee from Wammy's House all the way to Los Angeles, CA. Then, 3 years after running away (he is now 18 years old), he joins forces with Rod Ross, the Mafia Boss (not for long though). Then, to gain trust of the mafia Rod Runs, because Rod Ross Runs The Mafia Cause Rod Ross the Mafia Boss (tongue twister copyright me 2025) Mello kills/destroys rival mob bosses that "even Kira couldn't catch", along with Mello's invaluable advice, so Mello is made Mello the Mafia Boss and the mafia goes in pursuit of Kira along with Mello in exchange of Mello's intelligence and importance/usefulness to the mafia's cause.

Then... his mafia base gets raided by Kira and the Task Force (many things happened before this by the way, but this'll be 700 years long of a page eheh), and then the base has to be detonated. Meaning, all the mafiosi died, and Mello explodes. HE SURVIVES THOUGH!!! With a very awesome sick burn scar on his left side of his face (from our POV though it's the right side of his face).

After that, Mello is left.. *singsong* ALLLL BYYY HIMSELLLLLLFFF~~~ ... So then he finds Halle Lidner (SPK Member but also Mello confidant) in New York and is like. "YOOO can I stay at your place n stuff" and she's like "yesssssssss ofccccccc". By the way, this is all happening when Mello is 19-20 in 2009. This is also where he goes to get the only existing photograph of himself from Near, which I think that part is really monumental but ill yap abt it in the possible Really Interesting/Awesome Mello Moments section ill make


I would go more into detail about this time, but this isn't about me retelling his whole story, it's me just explaining (and yapping) about his character and how ehjeksjhkjrkjgkejg he is and stuff I find cool and interesting abt him. This is also when he looks like this which I think is WAY hotter i mean awesomer than him before he exploded.

I will be adding more things later or updating this page!! ^_^